RAD26L Antibody
| Name | RAD26L Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-81944 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:SYFNSSSVNEFAKHITNATSEERQKMLRDFYASQYPEVKEFFVDSVSQFNNSSFEKGEQRTRKKSDKRESLIKPRLSDSETLSFKDSTN |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | RAD26L Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ERCC6L |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: RAD26L Antibody [NBP1-81944] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli and cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/24874_RAD26L-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-81944-img0005.jpg)
![Immunohistochemistry-Paraffin: RAD26L Antibody [NBP1-81944] - Staining of human pancreas shows strong positivity in exocrine pancreas.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/24875_RAD26L-Antibody-Immunohistochemistry-Paraffin-NBP1-81944-img0006.jpg)