CNOT6L Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-84186
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB ICC/IF IHC IHC-P
• Species Reactivities: Human, Rat
• Antigen: This antibody was developed against Recombinant Protein corresponding to amino acids:EVHKELFGAGMKPIHAADKQLLIVANAHMH
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: CNOT6L Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: CNOT6L
• Conjugate: Unconjugated

Product images

Western Blot: CNOT6L Antibody [NBP1-84186] - Analysis in human cell line MOLT-4.

Immunocytochemistry/Immunofluorescence: CNOT6L Antibody [NBP1-84186] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.

Immunohistochemistry-Paraffin: CNOT6L Antibody [NBP1-84186] - Staining of human gallbladder shows cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: CNOT6L Antibody [NBP1-84186] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.