SSRP1 Antibody
| Name | SSRP1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-84754 |
| Prices | $129.00, $419.00 |
| Sizes | 25 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB Simple Western IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:DDAEVSLMEVRFYVPPTQEDGVDPVEAFAQNVLSKADVIQATGDAICIFRELQCLTPRGRYDIRIYPTFLHLHGKTFDYKIPYTTVLRLFLLPHKDQRQMFFVISLDPPIKQGQTRYHFLILLFSKDEDISLTLNMNEEEVE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SSRP1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SSRP1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: SSRP1 Antibody [NBP1-84754] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: NTERA-2 High](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/29648_SSRP1-Antibody-Western-Blot-NBP1-84754-img0004.jpg)
Western Blot: SSRP1 Antibody [NBP1-84754] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: NTERA-2 High
![Immunohistochemistry-Paraffin: SSRP1 Antibody [NBP1-84754] - Staining of human testis shows strong nuclear positivity in cells of seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/29649_SSRP1-Antibody-Immunohistochemistry-Paraffin-NBP1-84754-img0002.jpg)
Immunohistochemistry-Paraffin: SSRP1 Antibody [NBP1-84754] - Staining of human testis shows strong nuclear positivity in cells of seminiferus ducts.
![Simple Western: SSRP1 Antibody [NBP1-84754] - Simple Western lane view shows a specific band for SSRP1 in 0.2 mg/ml of Ntera-2 lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/29650_SSRP1-Antibody-Simple-Western-NBP1-84754-img0005.jpg)
Simple Western: SSRP1 Antibody [NBP1-84754] - Simple Western lane view shows a specific band for SSRP1 in 0.2 mg/ml of Ntera-2 lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system.
![Simple Western: SSRP1 Antibody [NBP1-84754] - Electropherogram image of the corresponding Simple Western lane view. SSRP1 antibody was used at 1:25 dilution on Ntera-2 lysate(s) respectively.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/29651_SSRP1-Antibody-Simple-Western-NBP1-84754-img0007.jpg)
Simple Western: SSRP1 Antibody [NBP1-84754] - Electropherogram image of the corresponding Simple Western lane view. SSRP1 antibody was used at 1:25 dilution on Ntera-2 lysate(s) respectively.