DENND1A Antibody
| Name | DENND1A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-84742 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:KGSGAILNTVKTKANPAMKTVYKFAKDHAKMGIKEVKNRLKQKDIAENGCAPTPEEQLPKTAPSPLVEAKDPKLR |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | DENND1A Protein |
| Description | Rabbit Polyclonal |
| Gene | DENND1A |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: DENND1A Antibody [NBP1-84742] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli & cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/23064_DENND1A-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84742-img0005.jpg)
Immunocytochemistry/Immunofluorescence: DENND1A Antibody [NBP1-84742] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli & cytoplasm.
![Immunohistochemistry-Paraffin: DENND1A Antibody [NBP1-84742] - Immunohistochemical staining of human liver shows strong cytoplasmic and nuclear positivity in hepatocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/23065_DENND1A-Antibody-Immunohistochemistry-Paraffin-NBP1-84742-img0006.jpg)
Immunohistochemistry-Paraffin: DENND1A Antibody [NBP1-84742] - Immunohistochemical staining of human liver shows strong cytoplasmic and nuclear positivity in hepatocytes.