ALKBH4 Antibody

Name ALKBH4 Antibody
Supplier Novus Biologicals
Catalog NBP2-14737
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids: TYRFIYCSDTGWAVGTEESDFEGWAFPFPGVMLIEDFVTREEEAELVRLM DRDPWKLSQSGRRKQDYGPKVN
Purity/Format Immunogen affinity purified
Blocking Peptide ALKBH4 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene ALKBH4
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.