NSFL1C Antibody

Name NSFL1C Antibody
Supplier Novus Biologicals
Catalog NBP2-13677
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB ICC/IF IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids: EEEEGQRFYAGGSERSGQQIVGPPRKKSPNELVDDLFKGAKEHGAVAVER VTKSPGETSKPRPFAGGGYRLG
Purity/Format Immunogen affinity purified
Blocking Peptide NSFL1C Protein
Description Rabbit Polyclonal
Gene NSFL1C
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.