NSFL1C Antibody
| Name | NSFL1C Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13676 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: MAAERQEALREFVAVTGAEEDRARFFLESAGWDLQIALASFYEDGGDEDI VTISQATPSSVSRGTAPSDNRVTSFRDLIHDQDADEE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | NSFL1C Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | NSFL1C |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: NSFL1C Antibody [NBP2-13676] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/12758_NSFL1C-Antibody-Western-Blot-NBP2-13676-img0002.jpg)
Western Blot: NSFL1C Antibody [NBP2-13676] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
![Immunocytochemistry/Immunofluorescence: NSFL1C Antibody [NBP2-13676] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, plasma membrane & cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/12759_NSFL1C%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13676-img0004.jpg)
Immunocytochemistry/Immunofluorescence: NSFL1C Antibody [NBP2-13676] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, plasma membrane & cytosol.
![Immunohistochemistry-Paraffin: NSFL1C Antibody [NBP2-13676] - Staining of human testis shows distinct nuclear and cytoplasmic positivity in cells in seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/12760_NSFL1C-Antibody-Immunohistochemistry-Paraffin-NBP2-13676-img0001.jpg)
Immunohistochemistry-Paraffin: NSFL1C Antibody [NBP2-13676] - Staining of human testis shows distinct nuclear and cytoplasmic positivity in cells in seminiferus ducts.