ZRANB3 Antibody
| Name | ZRANB3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13605 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: TGSTLNGRKEKIQAEEGDKEKWDFLQFAEAWTPNDSSEELRKEALFTHFE KEKQHDIRSFFVPQPKKRQLMTSCDESKRFREENTVVSSDP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ZRANB3 Protein |
| Description | Rabbit Polyclonal |
| Gene | ZRANB3 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: ZRANB3 Antibody [NBP2-13605] - Staining of human cell line U-251 MG shows positivity in nucleus but not nucleoli & centrosome.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/23533_ZRANB3%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13605-img0002.jpg)
Immunocytochemistry/Immunofluorescence: ZRANB3 Antibody [NBP2-13605] - Staining of human cell line U-251 MG shows positivity in nucleus but not nucleoli & centrosome.
![Immunohistochemistry-Paraffin: ZRANB3 Antibody [NBP2-13605] - Staining of human uterus, pre-menopause shows strong cytoplasmic and membranous positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/23534_ZRANB3%2520Antibody-Immunohistochemistry-Paraffin-NBP2-13605-img0001.jpg)
Immunohistochemistry-Paraffin: ZRANB3 Antibody [NBP2-13605] - Staining of human uterus, pre-menopause shows strong cytoplasmic and membranous positivity in glandular cells.