DDX59 Antibody
| Name | DDX59 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13909 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: VELCGVKIVVVDEADTMLKMGFQQQVLDILENIPNDCQTILVSATIPTSI EQLASQLLHNPVRIITGEKNLPCANVRQIIL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | DDX59 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | DDX59 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: DDX59 Antibody [NBP2-13909] - Staining of human cell line U-2 OS shows positivity in cytoskeleton (actin filaments).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9941_DDX59%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13909-img0003.jpg)
Immunocytochemistry/Immunofluorescence: DDX59 Antibody [NBP2-13909] - Staining of human cell line U-2 OS shows positivity in cytoskeleton (actin filaments).
![Immunohistochemistry-Paraffin: DDX59 Antibody [NBP2-13909] - Staining of human prostate shows strong cytoplasmic and membranous positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9942_DDX59%2520Antibody-Immunohistochemistry-Paraffin-NBP2-13909-img0001.jpg)
Immunohistochemistry-Paraffin: DDX59 Antibody [NBP2-13909] - Staining of human prostate shows strong cytoplasmic and membranous positivity in glandular cells.