DYM Antibody
| Name | DYM Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13942 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: MTRTRDKYLHTNCLAALANMSAQFRSLHQYAAQRIISLFSLLSKKHNKVL EQATQSLRGSLSSNDVPLPDYAQDLNVIEEVIR |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | DYM Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | DYM |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: DYM Antibody [NBP2-13942] - Staining of human cell line U-251 MG shows positivity in cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11798_DYM-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13942-img0003.jpg)
![Immunohistochemistry-Paraffin: DYM Antibody [NBP2-13942] - Staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11799_DYM-Antibody-Immunohistochemistry-Paraffin-NBP2-13942-img0004.jpg)