ABH1 Antibody
| Name | ABH1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14283 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: SMVEPCSLEDWQVCASYLKTARVNMTVRQVLATDQNFPLEPIEDEKRDIS TEGFCHLDDQNSEVKRARIN |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ABH1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ALKBH1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: ABH1 Antibody [NBP2-14283] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9311_ABH1%2520Antibody-Western%2520Blot-NBP2-14283-img0003.jpg)
![Immunohistochemistry-Paraffin: ABH1 Antibody [NBP2-14283] - Staining of human cerebellum shows strong cytoplasmic and nuclear positivity in Purkinje cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9312_ABH1-Antibody-Immunohistochemistry-Paraffin-NBP2-14283-img0001.jpg)