ABCA7 Antibody
| Name | ABCA7 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14250 |
| Prices | $129.00, $419.00 |
| Sizes | 25 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: VNRTFEELTLLRDVREVWEMLGPRIFTFMNDSSNVAMLQRLLQMQDEGRR QPRPGGRDHMEALRSFLDPGSGGYSWQDAHADVGHL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ABCA7 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ABCA7 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: ABCA7 Antibody [NBP2-14250] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane, the Golgi apparatus & cell junctions.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/22446_ABCA7%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-14250-img0009.jpg)
Immunocytochemistry/Immunofluorescence: ABCA7 Antibody [NBP2-14250] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane, the Golgi apparatus & cell junctions.
![Immunohistochemistry-Paraffin: ABCA7 Antibody [NBP2-14250] - Immunohistochemical staining of human spleen shows strong cytoplasmic positivity in a subset of cells in red pulp.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/22447_ABCA7-Antibody-Immunohistochemistry-Paraffin-NBP2-14250-img0008.jpg)
Immunohistochemistry-Paraffin: ABCA7 Antibody [NBP2-14250] - Immunohistochemical staining of human spleen shows strong cytoplasmic positivity in a subset of cells in red pulp.
![Immunohistochemistry-Paraffin: ABCA7 Antibody [NBP2-14250] - Immunohistochemical staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/22448_ABCA7-Antibody-Immunohistochemistry-Paraffin-NBP2-14250-img0003.jpg)
Immunohistochemistry-Paraffin: ABCA7 Antibody [NBP2-14250] - Immunohistochemical staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.
![Immunohistochemistry-Paraffin: ABCA7 Antibody [NBP2-14250] - Immunohistochemical staining of human prostate shows moderate to strong cytoplasmic positivity in leukocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/22449_ABCA7-Antibody-Immunohistochemistry-Paraffin-NBP2-14250-img0005.jpg)
Immunohistochemistry-Paraffin: ABCA7 Antibody [NBP2-14250] - Immunohistochemical staining of human prostate shows moderate to strong cytoplasmic positivity in leukocytes.