CatSper2 Antibody
| Name | CatSper2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14439 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: SESIGRLDWETLVHENLPGLMEMDQDDRVWPRDSLFRYFELLEKLQYNLE ERKKLQEFAVQALMNLED |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | CatSper2 Protein |
| Description | Rabbit Polyclonal |
| Gene | CATSPER2 |
| Supplier Page | Shop |
Product images
![Western Blot: CatSper2 Antibody [NBP2-14439] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/23911_CatSper2%2520Antibody-Western%2520Blot-NBP2-14439-img0003.jpg)
Western Blot: CatSper2 Antibody [NBP2-14439] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
Lane 6: Human tonsil tissue
![Immunohistochemistry-Paraffin: CatSper2 Antibody [NBP2-14439] - Staining of human soft tissue shows strong positivity in adipocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/23912_CatSper2-Antibody-Immunohistochemistry-Paraffin-NBP2-14439-img0001.jpg)
Immunohistochemistry-Paraffin: CatSper2 Antibody [NBP2-14439] - Staining of human soft tissue shows strong positivity in adipocytes.