ARHGAP10 Antibody
| Name | ARHGAP10 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14503 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: DGGSFGDWASTIPGQTRSSMVQWLNPQSPTTTSSNSAVTPLSPGSSPFPF SPPATVADKPPESIRSRKARAVYPCEAEHSSEL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ARHGAP10 Protein |
| Description | Rabbit Polyclonal |
| Gene | ARHGAP10 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: ARHGAP10 Antibody [NBP2-14503] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli & cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/23977_ARHGAP10%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-14503-img0002.jpg)
Immunocytochemistry/Immunofluorescence: ARHGAP10 Antibody [NBP2-14503] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli & cytoplasm.
![Immunohistochemistry-Paraffin: ARHGAP10 Antibody [NBP2-14503] - Staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/23978_ARHGAP10%2520Antibody-Immunohistochemistry-Paraffin-NBP2-14503-img0001.jpg)
Immunohistochemistry-Paraffin: ARHGAP10 Antibody [NBP2-14503] - Staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.