PEG10 Antibody
| Name | PEG10 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13749 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: QCIHIERRLARAAAARKPRSPPRALVLPHIASHHQVDPTEPVGGARMRLT QEEKERRRKLNLCLYCGTGGHYADNCPAKASKSS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PEG10 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PEG10 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: PEG10 Antibody [NBP2-13749] - Immunofluorescent staining of human cell line Hep G2 shows localization to nucleus & cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/21077_PEG10%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13749-img0004.jpg)
Immunocytochemistry/Immunofluorescence: PEG10 Antibody [NBP2-13749] - Immunofluorescent staining of human cell line Hep G2 shows localization to nucleus & cytosol.
![Immunohistochemistry-Paraffin: PEG10 Antibody [NBP2-13749] - Staining of human placenta shows strong cytoplasmic positivity in a subset of trophoblastic cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/21078_PEG10-Antibody-Immunohistochemistry-Paraffin-NBP2-13749-img0002.jpg)
Immunohistochemistry-Paraffin: PEG10 Antibody [NBP2-13749] - Staining of human placenta shows strong cytoplasmic positivity in a subset of trophoblastic cells.