POLR3H Antibody
| Name | POLR3H Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13787 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: GFFDDILIPPESLQQPAKFDEAEQVWVWEYETEEGAHDLYMDTGEEIRFR VVDESFVDTSPTGPSSADATTSSEELPKKEAPYTLVG |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | POLR3H Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | POLR3H |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: POLR3H Antibody [NBP2-13787] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & centrosome.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9677_POLR3H%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13787-img0003.jpg)
Immunocytochemistry/Immunofluorescence: POLR3H Antibody [NBP2-13787] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & centrosome.
![Immunohistochemistry-Paraffin: POLR3H Antibody [NBP2-13787] - Staining of human stomach, lower shows moderate nuclear positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9678_POLR3H-Antibody-Immunohistochemistry-Paraffin-NBP2-13787-img0001.jpg)
Immunohistochemistry-Paraffin: POLR3H Antibody [NBP2-13787] - Staining of human stomach, lower shows moderate nuclear positivity in glandular cells.