LRRC16A Antibody
| Name | LRRC16A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-91222 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:HKLADHFSRRGKTLPQQESLEIELAEEKPVKRSIITVEELTEIERLEDLDTCMMTPKSKRKSIHSRMLRPVSRAFEMEFDL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | LRRC16A Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | LRRC16A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: LRRC16A Antibody [NBP1-91222] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/5570_LRRC16A%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-91222-img0006.jpg)
Immunocytochemistry/Immunofluorescence: LRRC16A Antibody [NBP1-91222] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
![Immunohistochemistry-Paraffin: LRRC16A Antibody [NBP1-91222] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/5571_LRRC16A-Antibody-Immunohistochemistry-Paraffin-NBP1-91222-img0005.jpg)
Immunohistochemistry-Paraffin: LRRC16A Antibody [NBP1-91222] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.