U2AF2 Antibody
| Name | U2AF2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-33397 |
| Prices | $129.00, $419.00 |
| Sizes | 25 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB Simple Western IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: PDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNATLVS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | U2AF2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | U2AF2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: U2AF2 Antibody [NBP2-33397] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: HEK 293](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6352_U2AF2%2520Antibody-Western%2520Blot-NBP2-33397-img0004.jpg)
Western Blot: U2AF2 Antibody [NBP2-33397] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: HEK 293
![Immunohistochemistry: U2AF2 Antibody [NBP2-33397] - Staining of human colon shows strong nuclear positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6353_U2AF2-Antibody-Immunohistochemistry-NBP2-33397-img0001.jpg)
Immunohistochemistry: U2AF2 Antibody [NBP2-33397] - Staining of human colon shows strong nuclear positivity in glandular cells.
![Simple Western: U2AF2 Antibody [NBP2-33397] - Simple Western lane view shows a specific band for U2AF2 in 0.2 mg/ml of HEK 293T lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6354_U2AF2-Antibody-Simple-Western-NBP2-33397-img0005.jpg)
Simple Western: U2AF2 Antibody [NBP2-33397] - Simple Western lane view shows a specific band for U2AF2 in 0.2 mg/ml of HEK 293T lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system.
![Simple Western: U2AF2 Antibody [NBP2-33397] - Electropherogram image of the corresponding Simple Western lane view. U2AF2 antibody was used at 1:25 dilution on HEK 293T lysate(s) respectively.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6355_U2AF2-Antibody-Simple-Western-NBP2-33397-img0006.jpg)
Simple Western: U2AF2 Antibody [NBP2-33397] - Electropherogram image of the corresponding Simple Western lane view. U2AF2 antibody was used at 1:25 dilution on HEK 293T lysate(s) respectively.