TID1 Antibody
| Name | TID1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-33416 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: IAQALLGGTARAQGLYETINVTIPPGTQTDQKIRMGGKGIPRINSYGYGDHYIHIKIRVPKRLTSRQQSLILSYAEDETDVEGTVNGVTLTSS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | TID1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | DNAJA3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: TID1 Antibody [NBP2-33416] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10405_TID1%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-33416-img0005.jpg)
Immunocytochemistry/Immunofluorescence: TID1 Antibody [NBP2-33416] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
![Immunohistochemistry-Paraffin: TID1 Antibody [NBP2-33416] - Staining of human cerebral cortex shows strong, granular cytoplasmic positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10406_TID1-Antibody-Immunohistochemistry-Paraffin-NBP2-33416-img0004.jpg)
Immunohistochemistry-Paraffin: TID1 Antibody [NBP2-33416] - Staining of human cerebral cortex shows strong, granular cytoplasmic positivity in neuronal cells.