MRGX2 Antibody
| Name | MRGX2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-33744 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: ALQRALQDIAEVDHSEGCFRQGTPEMSRSS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | MRGX2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | MRGPRX2 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: MRGX2 Antibody [NBP2-33744] - duodenum](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/24831_MRGX2-Antibody-Immunohistochemistry-Paraffin-NBP2-33744-img0002.jpg)
Immunohistochemistry-Paraffin: MRGX2 Antibody [NBP2-33744] - duodenum
![Immunohistochemistry-Paraffin: MRGX2 Antibody [NBP2-33744] - Immunohistochemical staining of human cerebral cortex shows weak cytoplasmic positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/24832_MRGX2-Antibody-Immunohistochemistry-Paraffin-NBP2-33744-img0001.jpg)
Immunohistochemistry-Paraffin: MRGX2 Antibody [NBP2-33744] - Immunohistochemical staining of human cerebral cortex shows weak cytoplasmic positivity in neuronal cells.
![Immunohistochemistry-Paraffin: MRGX2 Antibody [NBP2-33744] - liver cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/24833_MRGX2%2520Antibody-Immunohistochemistry-Paraffin-NBP2-33744-img0003.jpg)
Immunohistochemistry-Paraffin: MRGX2 Antibody [NBP2-33744] - liver cancer