CYLD Antibody
| Name | CYLD Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-33589 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: PPLEINSRVSLKVGETIESGTVIFCDVLPGKESLGYFVGVDMDNPIGNWDGRFDGVQLCSFACVESTILLHINDIIPESVTQER |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | CYLD Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CYLD |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: CYLD Antibody [NBP2-33589] - Staining of human cell line A-431 shows localization to microtubule organizing center.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/4393_CYLD-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-33589-img0003.jpg)
![Immunohistochemistry-Paraffin: CYLD Antibody [NBP2-33589] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/4394_CYLD-Antibody-Immunohistochemistry-Paraffin-NBP2-33589-img0002.jpg)