NTAN1 Antibody
| Name | NTAN1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-33615 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: SDHAQCGRLEVHLVGGFSDDRQLSQKLTHQLLSEFDRQEDDIHLVTLCVTELNDREENENHFPVIYGIAVNIKTAEIYRASFQDRGP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | NTAN1 Protein |
| Description | Rabbit Polyclonal |
| Gene | NTAN1 |
| Supplier Page | Shop |
![Immunohistochemistry-Paraffin: NTAN1 Antibody [NBP2-33615] - pancreas](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/25150_NTAN1-Antibody-Immunohistochemistry-Paraffin-NBP2-33615-img0002.jpg)
![Immunohistochemistry-Paraffin: NTAN1 Antibody [NBP2-33615] - Immunohistochemical staining of human lung shows strong cytoplasmic positivity in pneumocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/25151_NTAN1-Antibody-Immunohistochemistry-Paraffin-NBP2-33615-img0001.jpg)
![Immunohistochemistry-Paraffin: NTAN1 Antibody [NBP2-33615] - liver cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/25152_NTAN1%2520Antibody-Immunohistochemistry-Paraffin-NBP2-33615-img0003.jpg)