Jarid1D Antibody
| Name | Jarid1D Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-33548 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: RQKVDQGRNVENLVQQELQSKRARSSGIMSQVGREEEHYQEKADRENMFLTPSTDHSPFLKGNQ |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Jarid1D Protein |
| Description | Rabbit Polyclonal |
| Gene | KDM5D |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: Jarid1D Antibody [NBP2-33548] - cerebellum](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/25293_Jarid1D-Antibody-Immunohistochemistry-NBP2-33548-img0002.jpg)
Immunohistochemistry: Jarid1D Antibody [NBP2-33548] - cerebellum
![Immunohistochemistry: Jarid1D Antibody [NBP2-33548] - Immunohistochemical staining of human cerebellum shows strong cytoplasmic and nuclear positivity in Purkinje cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/25294_Jarid1D-Antibody-Immunohistochemistry-NBP2-33548-img0001.jpg)
Immunohistochemistry: Jarid1D Antibody [NBP2-33548] - Immunohistochemical staining of human cerebellum shows strong cytoplasmic and nuclear positivity in Purkinje cells.
![Western Blot: Jarid1D Antibody [NBP2-33548] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: HEL](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_5/29995_Jarid1D%2520Antibody-Western%2520Blot-NBP2-33548-img0004.jpg)
Western Blot: Jarid1D Antibody [NBP2-33548] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: HEL
![Immunohistochemistry: Jarid1D Antibody [NBP2-33548] - testis cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_5/29996_Jarid1D-Antibody-Immunohistochemistry-NBP2-33548-img0003.jpg)
Immunohistochemistry: Jarid1D Antibody [NBP2-33548] - testis cancer