APLP-2 Antibody
| Name | APLP-2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-89029 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:PYVAQEIQEEIDELLQEQRADMDQFTASISETPVDVRVSSEESEEIPPFHPFHPFPALPENEDTQPELYHPMK |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | APLP-2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | APLP2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: APLP-2 Antibody [NBP1-89029] - Staining of human cell line A-431 shows positivity in cytoplasm and vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/14893_APLP-2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89029-img0004.jpg)
Immunocytochemistry/Immunofluorescence: APLP-2 Antibody [NBP1-89029] - Staining of human cell line A-431 shows positivity in cytoplasm and vesicles.
![Immunohistochemistry-Paraffin: APLP-2 Antibody [NBP1-89029] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/14894_APLP-2-Antibody-Immunohistochemistry-Paraffin-NBP1-89029-img0002.jpg)
Immunohistochemistry-Paraffin: APLP-2 Antibody [NBP1-89029] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
![Immunocytochemistry/Immunofluorescence: APLP-2 Antibody [NBP1-89029] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/14895_APLP-2%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89029-img0005.jpg)
Immunocytochemistry/Immunofluorescence: APLP-2 Antibody [NBP1-89029] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.