SLC7A2 Antibody
| Name | SLC7A2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-88909 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:RHSLEGHLRDENNEEDAYPDNVHAAAEEKSAIQANDHHPRNLSSPFIFHE |
| Description | Rabbit Polyclonal |
| Gene | SLC7A2 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: SLC7A2 Antibody [NBP1-88909] Staining of human cell line U-2 OS shows positivity in cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/25507_SLC7A2%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88909-img0003.jpg)
Immunocytochemistry/Immunofluorescence: SLC7A2 Antibody [NBP1-88909] Staining of human cell line U-2 OS shows positivity in cytoplasm.
![Immunohistochemistry-Paraffin: SLC7A2 Antibody [NBP1-88909] - Immunohistochemical staining of human stomach shows strong membranous and cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/25508_SLC7A2%2520Antibody-Immunohistochemistry-Paraffin-NBP1-88909-img0001.jpg)
Immunohistochemistry-Paraffin: SLC7A2 Antibody [NBP1-88909] - Immunohistochemical staining of human stomach shows strong membranous and cytoplasmic positivity in glandular cells.