SCIN Antibody
| Name | SCIN Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-89231 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:RELYHEEFARAGKQAGLQVWRIEKLELVPVPQSAHGDFYVGDAYLVLHTAKTSRGFTYHLHFWLGKECSQDES |
| Description | Rabbit Polyclonal |
| Gene | SCIN |
| Supplier Page | Shop |
![Western Blot: SCIN Antibody [NBP1-89231] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/25601_SCIN%2520Antibody-Western%2520Blot-NBP1-89231-img0004.jpg)
![Immunohistochemistry-Paraffin: SCIN Antibody [NBP1-89231] - Staining of human kidney shows strong cytoplasmic positivity in tubular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/25602_SCIN-Antibody-Immunohistochemistry-Paraffin-NBP1-89231-img0002.jpg)