INPP5B Antibody
| Name | INPP5B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-89439 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:SRLLGLVRYRLEHGGQEHALFLYTHRRMAITGDDVSLDQIVPVSRDFTLEEVSPDGELYILGSDVTV |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | INPP5B Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | INPP5B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: INPP5B Antibody [NBP1-89439] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25190_INPP5B%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89439-img0004.jpg)
Immunocytochemistry/Immunofluorescence: INPP5B Antibody [NBP1-89439] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
![Immunohistochemistry-Paraffin: INPP5B Antibody [NBP1-89439] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25191_INPP5B-Antibody-Immunohistochemistry-Paraffin-NBP1-89439-img0002.jpg)
Immunohistochemistry-Paraffin: INPP5B Antibody [NBP1-89439] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.