FEM1B Antibody
| Name | FEM1B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-89422 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:NDRENYDIIKTYHYLYLAMLERFQDGDNILEKEVLPPIHAYGNRTECRNPQELESIRQDRDALHMEGLIVRERILGADNIDVSHPIIY |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | FEM1B Protein |
| Description | Rabbit Polyclonal |
| Gene | FEM1B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: FEM1B Antibody [NBP1-89422] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9777_FEM1B-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89422-img0006.jpg)
Immunocytochemistry/Immunofluorescence: FEM1B Antibody [NBP1-89422] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
![Immunohistochemistry-Paraffin: FEM1B Antibody [NBP1-89422] - Staining of human testis shows strong nuclear and cytoplasmic positivity in cells in seminiferous ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9778_FEM1B%2520Antibody-Immunohistochemistry-Paraffin-NBP1-89422-img0007.jpg)
Immunohistochemistry-Paraffin: FEM1B Antibody [NBP1-89422] - Staining of human testis shows strong nuclear and cytoplasmic positivity in cells in seminiferous ducts.