Pyruvate Dehydrogenase E1 beta subunit Antibody

Name Pyruvate Dehydrogenase E1 beta subunit Antibody
Supplier Novus Biologicals
Catalog NBP1-87421
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:MAGLRPICEFMTFNFSMQAIDQVINSAAKTYYMSGGLQPVPIVFRGPNGASAGVAAQHSQCFAAWYGHCPGLKVVSPWNSEDAKG
Purity/Format Immunogen affinity purified
Blocking Peptide Pyruvate Dehydrogenase E1 beta subunit Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene PDHB
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.