MAST205 Antibody
| Name | MAST205 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-87900 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:GESGEEDPFPSRDPRSLGPMVPSLLTGITLGPPRMESPSGPHRRLGSPQAIEEAASSSSAGPNLGQSG |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | MAST205 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | MAST2 |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: MAST205 Antibody [NBP1-87900] Staining of human cell line A-431 shows positivity in cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/26475_MAST205%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87900-img0003.jpg)
![Immunohistochemistry-Paraffin: MAST205 Antibody [NBP1-87900] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/26476_MAST205%2520Antibody-Immunohistochemistry-Paraffin-NBP1-87900-img0002.jpg)