DHFRL1 Antibody
| Name | DHFRL1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-33268 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: PLRNEFRYFQRMTTTSSVEGKQNLVIMGRK |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | DHFRL1 Protein |
| Description | Rabbit Polyclonal |
| Gene | DHFRL1 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: DHFRL1 Antibody [NBP2-33268] - tonsil](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/26590_DHFRL1-Antibody-Immunohistochemistry-Paraffin-NBP2-33268-img0002.jpg)
Immunohistochemistry-Paraffin: DHFRL1 Antibody [NBP2-33268] - tonsil
![Immunohistochemistry-Paraffin: DHFRL1 Antibody [NBP2-33268] - Immunohistochemical staining of human heart muscle shows strong cytoplasmic positivity in myocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/26591_DHFRL1-Antibody-Immunohistochemistry-Paraffin-NBP2-33268-img0001.jpg)
Immunohistochemistry-Paraffin: DHFRL1 Antibody [NBP2-33268] - Immunohistochemical staining of human heart muscle shows strong cytoplasmic positivity in myocytes.
![Immunohistochemistry-Paraffin: DHFRL1 Antibody [NBP2-33268] - liver cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/26592_DHFRL1%2520Antibody-Immunohistochemistry-Paraffin-NBP2-33268-img0003.jpg)
Immunohistochemistry-Paraffin: DHFRL1 Antibody [NBP2-33268] - liver cancer