NeuroD2 Antibody
| Name | NeuroD2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-32545 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: DSSPDHEKSYHYSMHYSALPGSRPTGHGLVFGSSAVRGGVHSENLLSYDMHLHHDRGPLYE |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | NEUROD2 |
| Supplier Page | Shop |
![Immunohistochemistry: NeuroD2 Antibody [NBP2-32545] - liver cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/26608_NeuroD2%2520Antibody-Immunohistochemistry-NBP2-32545-img0006.jpg)
![Immunohistochemistry: NeuroD2 Antibody [NBP2-32545] - Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/26609_NeuroD2-Antibody-Immunohistochemistry-NBP2-32545-img0001.jpg)
![Immunohistochemistry: NeuroD2 Antibody [NBP2-32545] - placenta](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/26610_NeuroD2-Antibody-Immunohistochemistry-NBP2-32545-img0002.jpg)