Timeless Antibody
| Name | Timeless Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-32559 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: FVELLFWKNTAVVREMTEGYGSLDDRSSSRRAPTWSPEEEAHLQELYLANKDVEGQDVVEAILAHLNTVPRTRKQIIHHLVQMGLADSVKDFQR |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Timeless Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | TIMELESS |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Timeless Antibody [NBP2-32559] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: U-251 MG](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15535_Timeless-Antibody-Western-Blot-NBP2-32559-img0007.jpg)
Western Blot: Timeless Antibody [NBP2-32559] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: U-251 MG
![Immunocytochemistry/Immunofluorescence: Timeless Antibody [NBP2-32559] - Staining of human cell line MCF7 shows localization to nucleus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15536_Timeless-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-32559-img0008.jpg)
Immunocytochemistry/Immunofluorescence: Timeless Antibody [NBP2-32559] - Staining of human cell line MCF7 shows localization to nucleus.
![Immunohistochemistry-Paraffin: Timeless Antibody [NBP2-32559] - Staining of human testis shows strong nuclear positivity in subset of cells in seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15537_Timeless-Antibody-Immunohistochemistry-Paraffin-NBP2-32559-img0009.jpg)
Immunohistochemistry-Paraffin: Timeless Antibody [NBP2-32559] - Staining of human testis shows strong nuclear positivity in subset of cells in seminiferus ducts.