hydroxysteroid (17-beta) dehydrogenase 11 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-90334
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB Simple Western ICC/IF IHC IHC-P
• Species Reactivities: Human
• Antigen: This antibody was developed against Recombinant Protein corresponding to amino acids:FVNTGFIKNPSTSLGPTLEPEEVVNRLMHGILTEQKMIFIPSSIAFLTTLERILPERFLAVLKRKISVKFDAVIGY
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: hydroxysteroid (17-beta) dehydrogenase 11 Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: HSD17B11
• Conjugate: Unconjugated

Product images

Western Blot: hydroxysteroid (17-beta) dehydrogenase 11 Antibody [NBP1-90334] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Hep-G2

Immunocytochemistry/Immunofluorescence: hydroxysteroid (17-beta) dehydrogenase 11 Antibody [NBP1-90334] - Staining of human cell line U-2 OS shows localization to lipid droplets.

Immunohistochemistry-Paraffin: hydroxysteroid (17-beta) dehydrogenase 11 Antibody [NBP1-90334] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Simple Western: hydroxysteroid (17-beta) dehydrogenase 11 Antibody [NBP1-90334] - Simple Western: hydroxysteroid (17-beta) dehydrogenase 11 Antibody [NBP1-90334] - Simple Western lane view shows a specific band for hydroxysteroid (17-beta) dehydrogenase 11 in 0.2 mg/ml of HepG2 lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: hydroxysteroid (17-beta) dehydrogenase 11 Antibody [NBP1-90334] - Simple Western: hydroxysteroid (17-beta) dehydrogenase 11 Antibody [NBP1-90334] - Electropherogram image of the corresponding Simple Western lane view. hydroxysteroid (17-beta) dehydrogenase 11 antibody was used at 1:25 dilution on HepG2 lysate(s) respectively.