CACNA2D3 Antibody
| Name | CACNA2D3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-33938 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: WHSDMTAKAQKLKQTLEPCDTEYPAFVSERTIKETTGNIACEDCSKSFVIQQIPSSNLFMVVVD |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | CACNA2D3 Protein |
| Description | Rabbit Polyclonal |
| Gene | CACNA2D3 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: CACNA2D3 Antibody [NBP2-33938] - heart muscle](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/27272_CACNA2D3-Antibody-Immunohistochemistry-Paraffin-NBP2-33938-img0002.jpg)
Immunohistochemistry-Paraffin: CACNA2D3 Antibody [NBP2-33938] - heart muscle
![Immunohistochemistry-Paraffin: CACNA2D3 Antibody [NBP2-33938] - Immunohistochemical staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/27273_CACNA2D3-Antibody-Immunohistochemistry-Paraffin-NBP2-33938-img0001.jpg)
Immunohistochemistry-Paraffin: CACNA2D3 Antibody [NBP2-33938] - Immunohistochemical staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
![Immunohistochemistry-Paraffin: CACNA2D3 Antibody [NBP2-33938] - liver cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/27274_CACNA2D3%2520Antibody-Immunohistochemistry-Paraffin-NBP2-33938-img0003.jpg)
Immunohistochemistry-Paraffin: CACNA2D3 Antibody [NBP2-33938] - liver cancer