AOC2 Antibody
| Name | AOC2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-33849 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: LDPAHWTVQQVFYLGHYYADLGQLEREFKSGRLEVVRVPLPPPNGASSLRSRNSPGPLPPLQFSPQGSQYS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | AOC2 Protein |
| Description | Rabbit Polyclonal |
| Gene | AOC2 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: AOC2 Antibody [NBP2-33849] - liver](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/27537_AOC2-Antibody-Immunohistochemistry-Paraffin-NBP2-33849-img0002.jpg)
Immunohistochemistry-Paraffin: AOC2 Antibody [NBP2-33849] - liver
![Immunohistochemistry-Paraffin: AOC2 Antibody [NBP2-33849] - Immunohistochemical staining of human lymph node shows strong cytoplasmic and nuclear positivity in non-germinal center cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/27538_AOC2-Antibody-Immunohistochemistry-Paraffin-NBP2-33849-img0001.jpg)
Immunohistochemistry-Paraffin: AOC2 Antibody [NBP2-33849] - Immunohistochemical staining of human lymph node shows strong cytoplasmic and nuclear positivity in non-germinal center cells.
![Immunohistochemistry-Paraffin: AOC2 Antibody [NBP2-33849] - liver cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/27539_AOC2%2520Antibody-Immunohistochemistry-Paraffin-NBP2-33849-img0003.jpg)
Immunohistochemistry-Paraffin: AOC2 Antibody [NBP2-33849] - liver cancer