PSMG1 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP2-33820
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: ICC/IF IHC IHC-P
• Species Reactivities: Human
• Antigen: This antibody was developed against a recombinant protein corresponding to amino acids: CCPLLEQPNIVHDLPAAVLSYCQVWKIPAILYLCYTDVMKLDLITVEAFKPILSTRSLKGLVKNIPQSTEILKKLMTTNEIQSNIYT
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: PSMG1 Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: PSMG1
• Conjugate: Unconjugated

Product images

Immunocytochemistry/Immunofluorescence: PSMG1 Antibody [NBP2-33820] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol & the Golgi apparatus.

Immunohistochemistry: PSMG1 Antibody [NBP2-33820] - Staining of liver cancer.

Immunohistochemistry: PSMG1 Antibody [NBP2-33820] - Staining of human cerebellum shows strong granular cytoplasmic positivity in Purkinje cells.

Immunohistochemistry: PSMG1 Antibody [NBP2-33820] - Staining of cerebellum.