PARD6B Antibody

Name PARD6B Antibody
Supplier Novus Biologicals
Catalog NBP1-87337
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications ICC/IF IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:NYHKAVSTANPLLRIFIQKKEEADYSAFGTDTLIKKKNVLTNVLRPDNHRKKPHIVISMPQDFRPVSSIIDVDILPETHRRV
Purity/Format Immunogen affinity purified
Blocking Peptide PARD6B Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene PARD6B
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.