RAGEF2 Antibody
| Name | RAGEF2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-87301 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:SNCSVDSMSAALQDERCSSQALAVPESTGALEKTEHASGIGDHSQHGPGWTLLKPSLIKCLAVSSSVSNEEISQEHIIIEAADS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | RAGEF2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | RAPGEF6 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: RAGEF2 Antibody [NBP1-87301] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli and cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/5905_RAGEF2%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87301-img0003.jpg)
Immunocytochemistry/Immunofluorescence: RAGEF2 Antibody [NBP1-87301] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli and cytoplasm.
![Immunohistochemistry-Paraffin: RAGEF2 Antibody [NBP1-87301] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/5906_RAGEF2%2520Antibody-Immunohistochemistry-Paraffin-NBP1-87301-img0002.jpg)
Immunohistochemistry-Paraffin: RAGEF2 Antibody [NBP1-87301] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.