SynGAP Antibody
| Name | SynGAP Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-87841 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:LHLYRDSDKKRKKDKAGYVGLVTVPVATLAGRHFTEQWYPVTLPTGSGGSGGMGSGGGGGSGGGSGGKGKGGCPAVRLKARYQ |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SynGAP Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SYNGAP1 |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: SynGAP Antibody [NBP1-87841] - Staining of human cell line A-431 shows positivity in nucleus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/27732_SynGAP%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87841-img0003.jpg)
![Immunohistochemistry-Paraffin: SynGAP Antibody [NBP1-87841] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/27733_SynGAP%2520Antibody-Immunohistochemistry-Paraffin-NBP1-87841-img0002.jpg)