RENT1/UPF1/hUPF1 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-89641
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB ICC/IF IHC IHC-P
• Species Reactivities: Human, Rat
• Antigen: This antibody was developed against Recombinant Protein corresponding to amino acids:LEELWKENPSATLEDLEKPGVDEEPQHVLLRYEDAYQYQNIFGPLVKLEADYDKKLKESQTQDNITVRWDLGLNKKRIAYFTLPKTD
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: RENT1/UPF1/hUPF1 Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: UPF1
• Conjugate: Unconjugated

Product images

Western Blot: RENT1/UPF1/hUPF1 Antibody [NBP1-89641] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunocytochemistry/Immunofluorescence: RENT1/UPF1/hUPF1 Antibody [NBP1-89641] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.

Immunohistochemistry-Paraffin: RENT1/UPF1/hUPF1 Antibody [NBP1-89641] - Staining of human duodenum shows strong granular positivity in glandular cells.

Western Blot: RENT1/UPF1/hUPF1 Antibody [NBP1-89641] - Analysis in human cell line A-549.