MIA3 Antibody
| Name | MIA3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-34160 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: LGMNENNIFEEAAVLDDIQDLIYFVRYKHSTAEETATLVMAPPLEEGLGGAMEEMQPLHEDNFSREKTAELNVQVPEEPTHLDQRVI |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | MIA3 Protein |
| Description | Rabbit Polyclonal |
| Gene | MIA3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: MIA3 Antibody [NBP2-34160] - Immunofluorescent staining of human cell line U-251 MG shows localization to vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6492_MIA3%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-34160-img0005.jpg)
Immunocytochemistry/Immunofluorescence: MIA3 Antibody [NBP2-34160] - Immunofluorescent staining of human cell line U-251 MG shows localization to vesicles.
![Immunohistochemistry-Paraffin: MIA3 Antibody [NBP2-34160] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6493_MIA3-Antibody-Immunohistochemistry-Paraffin-NBP2-34160-img0001.jpg)
Immunohistochemistry-Paraffin: MIA3 Antibody [NBP2-34160] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.