Melanoma antigen family C2 Antibody

Name Melanoma antigen family C2 Antibody
Supplier Novus Biologicals
Catalog NBP2-34145
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications ICC/IF IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against a recombinant protein corresponding to amino acids: PVPGVPFRNVDNDSPTSVELEDWVDAQHPTDEEEEEASSASSTLYLVFSPS
Purity/Format Immunogen affinity purified
Blocking Peptide Melanoma antigen family C2 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene MAGEC2
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.