Glypican 1 Antibody
| Name | Glypican 1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-89759 |
| Prices | $129.00, $419.00 |
| Sizes | 25 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:DAEWRNLLDSMVLITDKFWGTSGVESVIGSVHTWLAEAINALQDNRDTLTAKVIQGCGNPKVNPQGPGPEEKRR |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Glypican 1 Protein |
| Description | Rabbit Polyclonal |
| Gene | GPC1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Glypican 1 Antibody [NBP1-89759] - Analysis in human cell line A-549.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/22233_Glypican-1-Antibody-Western-Blot-NBP1-89759-img0005.jpg)
Western Blot: Glypican 1 Antibody [NBP1-89759] - Analysis in human cell line A-549.
![Immunocytochemistry/Immunofluorescence: Glypican 1 Antibody [NBP1-89759] - Staining of human cell line HaCaT shows localization to plasma membrane & cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/22234_Glypican-1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89759-img0006.jpg)
Immunocytochemistry/Immunofluorescence: Glypican 1 Antibody [NBP1-89759] - Staining of human cell line HaCaT shows localization to plasma membrane & cytosol.
![Immunohistochemistry-Paraffin: Glypican 1 Antibody [NBP1-89759] - Immunohistochemical staining of human duodenum shows moderate positivity in luminal membrane.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/22235_Glypican-1-Antibody-Immunohistochemistry-Paraffin-NBP1-89759-img0001.jpg)
Immunohistochemistry-Paraffin: Glypican 1 Antibody [NBP1-89759] - Immunohistochemical staining of human duodenum shows moderate positivity in luminal membrane.