Histamine H4 R Antibody

Name Histamine H4 R Antibody
Supplier Novus Biologicals
Catalog NBP1-90058
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:QSHPGLTAVSSNICGHSFRGRLSSRRSLSASTEVPASFHSERQRRKSSLMFSSRTKMNSNTIASKMGSFSQSDSVALHQRE
Purity/Format Immunogen affinity purified
Blocking Peptide Histamine H4 R Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene HRH4
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.