Septin-4 Antibody

Name Septin-4 Antibody
Supplier Novus Biologicals
Catalog NBP1-90093
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications ICC/IF IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:TMLVRTHMQDLKDVTRETHYENYRAQCIQSMTRLVVKERNRNKLTRESGTDFPIPAVPPGTDPETEKLIREKDEELRRMQE
Purity/Format Immunogen affinity purified
Blocking Peptide Septin-4 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene SEPT4
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.