MARCH5 Antibody
| Name | MARCH5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-33050 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: EDYVLRLWRKYSNKLQILNSIFPGIGCPVPRIPAEANPLADHVSATRI |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | MARCH5 Protein |
| Description | Rabbit Polyclonal |
| Gene | MARCH5 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: MARCH5 Antibody [NBP2-33050] - liver cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/28680_MARCH5-Antibody-Immunohistochemistry-Paraffin-NBP2-33050-img0004.jpg)
Immunohistochemistry-Paraffin: MARCH5 Antibody [NBP2-33050] - liver cancer
![Immunohistochemistry-Paraffin: MARCH5 Antibody [NBP2-33050] - Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/28681_MARCH5-Antibody-Immunohistochemistry-Paraffin-NBP2-33050-img0001.jpg)
Immunohistochemistry-Paraffin: MARCH5 Antibody [NBP2-33050] - Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
![Immunohistochemistry-Paraffin: MARCH5 Antibody [NBP2-33050] - rectum](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/28682_MARCH5-Antibody-Immunohistochemistry-Paraffin-NBP2-33050-img0002.jpg)
Immunohistochemistry-Paraffin: MARCH5 Antibody [NBP2-33050] - rectum