DEDD2 Antibody
| Name | DEDD2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-91828 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:DYLSGALLQALRGVFLTEALREAVGREAVRLLVSVDEADYEAGRRRLLLMEEEG |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | DEDD2 Protein |
| Description | Rabbit Polyclonal |
| Gene | DEDD2 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: DEDD2 Antibody [NBP1-91828] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/28712_DEDD2-Antibody-Immunohistochemistry-Paraffin-NBP1-91828-img0002.jpg)
Immunohistochemistry-Paraffin: DEDD2 Antibody [NBP1-91828] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
![Western Blot: DEDD2 Antibody [NBP1-91828] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)<br/>Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/1408_DEDD2%2520Antibody-Western%2520Blot-NBP1-91828-img0005.jpg)
Western Blot: DEDD2 Antibody [NBP1-91828] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
![Western Blot: DEDD2 Antibody [NBP1-91828] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/1409_DEDD2-Antibody-Western-Blot-NBP1-91828-img0004.jpg)
Western Blot: DEDD2 Antibody [NBP1-91828] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp