EEA1 Antibody

Name EEA1 Antibody
Supplier Novus Biologicals
Catalog NBP1-91859
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB ICC/IF IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:QETFKQLQSDFYGRESELLATRQDLKSVEEKLSLAQEDLISNRNQIGNQNKLIQELKTAKATLEQDSAKKEQQLQERC
Purity/Format Immunogen affinity purified
Blocking Peptide EEA1 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene EEA1
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.