MTR Antibody
| Name | MTR Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-92146 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:PPATAFEGHMLLSGLEPFRIGPYTNFVNIGERCNVAGSRKFAKLIMAGNYEEALCVAKVQVEMGAQVLDVNMDDGMLDGPSAMTRF |
| Description | Rabbit Polyclonal |
| Gene | MTR |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: MTR Antibody [NBP1-92146] Staining of human cell line A-431 shows positivity in cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/28903_MTR%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-92146-img0004.jpg)
![Immunohistochemistry-Paraffin: MTR Antibody [NBP1-92146] - Staining of human pancreas shows moderate membranous and cytoplasmic positivity in exocrine glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/28904_MTR%2520Antibody-Immunohistochemistry-Paraffin-NBP1-92146-img0002.jpg)